PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA12G16170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 131aa    MW: 14062.1 Da    PI: 9.7328
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA12G16170.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof93.91.2e-294790649
           zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49
                      +cprC s++tkfCyynny+++qPr+fC+aCrryWt GG+lrn 
  ONIVA12G16170.1 47 EQCPRCASRDTKFCYYNNYNTAQPRHFCRACRRYWTLGGSLRNT 90
                     68*****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.1E-264794IPR003851Zinc finger, Dof-type
PROSITE profilePS5088423.03947101IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-184990IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MEAPLHQSPV PLLPPPRVVG VQQQQQQEAV VPPPPAMAAA AGGGGREQCP RCASRDTKFC  60
YYNNYNTAQP RHFCRACRRY WTLGGSLRNT MSPTAALAIF SRKSGAGCRS STIAIFLHKS  120
GAEAQLGTTS C
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126201e-145CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443463.15e-33hypothetical protein SORBIDRAFT_08g019830
TrEMBLA0A0E0JBV43e-93A0A0E0JBV4_ORYNI; Uncharacterized protein
STRINGBGIOSGA035911-PA2e-60(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.13e-21DOF zinc finger protein 1